PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn297341
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 132aa    MW: 15194.2 Da    PI: 8.4631
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn297341genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.5e-19344245
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     + WT+eE+ +l++a+kq+G++ W+tIa++++ gRt++ +k++w+
       Achn297341  3 DLWTEEEEMILIEAHKQMGNK-WATIAHKLP-GRTENTIKNHWN 44
                     56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.4E-16149IPR001005SANT/Myb domain
PROSITE profilePS5129422.49151IPR017930Myb domain
SuperFamilySSF466895.59E-16254IPR009057Homeodomain-like
PfamPF002492.8E-16444IPR001005SANT/Myb domain
CDDcd001672.56E-13547No hitNo description
Gene3DG3DSA:1.10.10.601.2E-19545IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MKDLWTEEEE MILIEAHKQM GNKWATIAHK LPGRTENTIK NHWNATKRRR FSKRKDKPNS  60
ILQEYIKSLS SNSVQDDAPK SPLLDQTGPI CNFDRAFNFS YGAKMSTESS AVDESNFDVK  120
GEMEFFKMLY P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1idz_A2e-17251554MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
1idy_A2e-17251554MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14854RRFSKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016567636.12e-29PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L22e-26MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0A0KUF71e-30A0A0A0KUF7_CUCSA; Uncharacterized protein
TrEMBLM1BJB52e-29M1BJB5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000466007e-29(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-27myb domain protein 98